Protein coding transcript 1284

• Transcript: Ll_transcript_478787
• CDS coordinates: 193-1602 (+)
• Peptide sequence: MFMNHSSECLLQLAQHCIKHQRQINQIHSLLITNGYILHNYYQKWMPTLLYNALIRAHHIAGLTHKSLLLFTQMLSNQVPPNSYTFPPVLKSAATYPPHLGTALHAQALKRGVLSDSFIQTTLVVTYARNNRVDHAWKVFEEIPYFCVVACNAMLNAFCTNGDIEGALSLFQRMPNRDVVSWTTVVNGFAVNGSYEAAIRLFGMMMAHKNVVDCLVKPNEATFVSVLSSCANLDSRAALDCGKQVHGYIVMNEVNLGVFVGTSLINLYGKMGCLNYAANVFDRMASREVCTWNAMISSLASNCKEKESLDMFEKMKVEGLQPNSITLVAVLTACARGNFVQEGLDLFRSMSHDFKVVPIMEHYGCVIDLLGRAGHLQEAADMIRNIPFQPDASVLGAFLGACKIHGAIELGEEIGRKMLKLQTQHCGQYVLLSSMNAEKERWDRAANLRKYIIEAGIHKIPAYSMVHLT*
• ORF Type: complete

Annotations of Ll_transcript_478787

• Blastp: Putative pentatricopeptide repeat-containing protein At1g10330 from Arabidopsis with 48.48% of identity
• Blastx: Putative pentatricopeptide repeat-containing protein At1g10330 from Arabidopsis with 48.48% of identity
• Eggnog: Pentatricopeptide repeat-containing protein(ENOG410Z7Z7)
• Kegg: Link to kegg annotations (AT1G10330)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019465178.1)
• Pfam: PPR repeat (PF01535.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;