Protein coding transcript 128584

• Transcript: Ll_transcript_317536
• CDS coordinates: 85-603 (+)
• Peptide sequence: MKIFKDVFTGDEMFSDTYKFKLVDDVLYEVYGKLVTRKQGEVNIDGFNPSAEDADEGTDEAVESGVDVVLNHRLVESYAFGDKKSYTAYLKDYMKKLVANLETNNPDQVDVFKTNMNKVMKEILGRFKDLQFFTGESMDVDGMIALLEYRDINNESVPVLMFFKHGLLEEKF*
• ORF Type: complete

Annotations of Ll_transcript_317536

• Blastp: Translationally-controlled tumor protein homolog from Plutella with 80.23% of identity
• Blastx: Translationally-controlled tumor protein homolog from Plutella with 80.23% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (105389397)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020967343.1)
• Pfam: Translationally controlled tumour protein (PF00838.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;