Transcript | Ll_transcript_478816 |
---|---|
CDS coordinates | 67-405 (+) |
Peptide sequence | MDTKLKSVTLLTLILLASFLATLLSVSEARPSPSEDGTVREVYGVFRTLKNSGPSPGVGHMHKKLQNLGDMKDSGPTPGIGHKPKTLQDLGVIKHSGPSPGEGHNFNTNIHP* |
ORF Type | complete |
Blastp | Precursor of CEP16 from Arabidopsis with 58.33% of identity |
---|---|
Blastx | - |
Eggnog | NA(ENOG4110853) |
Kegg | Link to kegg annotations (AT1G49800) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_004497272.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer