Protein coding transcript 12864

• Transcript: Ll_transcript_357642
• CDS coordinates: 257-1180 (+)
• Peptide sequence: MESVNSQQSCEKLMMVPMQIDGSHHAIAKGSSGSGSDEDARVNSFTRTSELTISFEGEVYVFPAVTPQKVQAVLLLLGGQEMPNSAPRSYCSLQQNYHDIGGINDPSQGSKHSRRFASLARFREKRKDRCFEKKIRYTCRKEVAERMHRKNGQFTSLKENYKPPAENCDSSNGTPCPESTERRCQHCGIGEKSTPAMRRGPAGPRSLCNACGLMWANKGTLRDLSKAGRVAFEHNELDTSADIKPSTTEPENSYADQNKEHIIETADTVTNNLSIQVENHDLSVHEQVFFSPFPYFESIMRYPGGKF*
• ORF Type: complete

Annotations of Ll_transcript_357642

• Blastp: GATA transcription factor 28 from Arabidopsis with 50.59% of identity
• Blastx: GATA transcription factor 28 from Arabidopsis with 50.59% of identity
• Eggnog: Transcription factor(COG5641)
• Kegg: Link to kegg annotations (AT1G51600)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019420264.1)
• Pfam: tify domain (PF06200.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;