Transcript | Ll_transcript_325376 |
---|---|
CDS coordinates | 1-405 (+) |
Peptide sequence | LRDSLAETVNRIGAKFIDTVRIDTTHFVCTEPRGQAWEKAVEMNVPVVVPDWVKGCEREGRIVGVRGYYLDADPKLRQMGTSAVQRSSVSTAAPRDSPRIEHTPPTPERPTRSERTFTDDGNSGRPQPPPKPSTD |
ORF Type | internal |
Blastp | - |
---|---|
Blastx | Chitin biosynthesis protein CHS5 from Candida with 43.84% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (CAALFM_C204140WA) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_017438829.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer