| Transcript | Ll_transcript_321046 |
|---|---|
| CDS coordinates | 2-319 (+) |
| Peptide sequence | THQSAYGSSHIVNLKEEDVLSGPDQIFRSRNSELRKQNSYWHGSTAPLSRFSNSVAARGDSRLDISGNSSLNSKWPEDQFGMGYSHQADGDSNQLLDEHKSSHKKD |
| ORF Type | internal |
| Blastp | Probable serine/threonine-protein kinase At1g09600 from Arabidopsis with 45.33% of identity |
|---|---|
| Blastx | - |
| Eggnog | Cyclin-Dependent Kinase(ENOG410XPIR) |
| Kegg | Link to kegg annotations (AT1G09600) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_013462376.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer