Protein coding transcript 12878

• Transcript: Ll_transcript_358035
• CDS coordinates: 951-1898 (+)
• Peptide sequence: MQLGYFVGSFQISAVGGWRFMYGFSAPVAVLMGLGMWALPASPRWLLLRAVQGKGSFQELKEKAIFSLSKLRGRPPGDKESERQIEETLISMKSAYADQESEGSFLEVFQGPNLKAFVIGGGLVFFQQITGQPSVLYYAGSILQSAGFSAASDATKVSVIIGIFKLLMTWVAVLKVDDLGRRPLLIGGVTGIALSLVLLSAYYKFLGGFPVVAVAALLLYVGSYQISFGPISWLMVSEIFPIRTRGRGISLAVLTNFASNAVVTFAFSPLKELLGADNLFLLFGAIALVSLLFVIFSVPETKGLSLEEIESKILN*
• ORF Type: complete

Annotations of Ll_transcript_358035

• Blastp: D-xylose-proton symporter-like 3, chloroplastic from Arabidopsis with 83.07% of identity
• Blastx: D-xylose-proton symporter-like 3, chloroplastic from Arabidopsis with 77.56% of identity
• Eggnog: Transporter(ENOG410XNQK)
• Kegg: Link to kegg annotations (AT5G59250)
• CantataDB: Link to cantataDB annotations (CNT0001067)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448611.1)
• Pfam: Sugar (and other) transporter (PF00083.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;