Protein coding transcript 128796

• Transcript: Ll_transcript_355554
• CDS coordinates: 1-489 (+)
• Peptide sequence: PQCYLRNEVKSSKAISIPYSNSNQPNTKSLVMENIEVLSKVLVLSIIIVFFILALIHVLCFYTQQLIFDAHHRSLQEGNNNSASGLDASVIGLIPVFAYNSNMCLENPISCVICLSEFQEGEMGRVLPKCNHVFHVDCIDMWLYSHTTCPHCRVSVELTPHV*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_355554

• Blastp: RING-H2 finger protein ATL2 from Arabidopsis with 36.2% of identity
• Blastx: RING-H2 finger protein ATL2 from Arabidopsis with 48.04% of identity
• Eggnog: zinc ion binding(ENOG41121N2)
• Kegg: Link to kegg annotations (AT3G16720)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439608.1)
• Pfam: Ring finger domain (PF13639.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;