Protein coding transcript 1288

• Transcript: Ll_transcript_478808
• CDS coordinates: 304-633 (+)
• Peptide sequence: MLRLALRRASSPANISRTILNPHWFVSGSASSPSLSIWRRKKEIGKEGLIVAKELKRLQSNPVRLDRFIQSQVSRLLKSDLVAVLAEFQRQDQVFLCMKVCACIFLFHC*
• ORF Type: complete

Annotations of Ll_transcript_478808

• Blastp: Pentatricopeptide repeat-containing protein At1g62350 from Arabidopsis with 75.41% of identity
• Blastx: Pentatricopeptide repeat-containing protein At1g62350 from Arabidopsis with 80.7% of identity
• Eggnog: Pentatricopeptide repeat-containing protein(ENOG410YBWY)
• Kegg: Link to kegg annotations (AT1G62350)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459267.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;