Protein coding transcript 12882

• Transcript: Ll_transcript_357713
• CDS coordinates: 3-650 (+)
• Peptide sequence: KGIAEFCPDAFVLVISNPVNSTVPIAAEVLTKAGVFNAKKLFGVTTLDVVRAETFVQSITGERDPAKTVIPVIGGHSGETIVPLLSQSGHNLEGQELADYVKRVQFGGDEVVQAKGGAGSATLSMAMAGARFAESLLKAAGGEKNVIEPSYVESPLFKDQGVTFFATNVELGPNGVEKIHEIGKVTEHEQKLVDVCVGQLKGNIEKGVKFVAENP*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_357713

• Blastp: Malate dehydrogenase, mitochondrial from Saccharomyces with 57.62% of identity
• Blastx: Malate dehydrogenase, mitochondrial from Saccharomyces with 57.62% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (YKL085W)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004510039.1)
• Pfam: lactate/malate dehydrogenase, NAD binding domain (PF00056.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;