Transcript | Ll_transcript_318397 |
---|---|
CDS coordinates | 277-795 (+) |
Peptide sequence | MSSSSSLSSKKHPVYHGIRRRGGKWVSEIREPRKANRIWLGTFLTPEMAAAAYDVAALALKGGEAVLNFPESMGKYPVPATNSSDDIRAAAIDAAALMNAPEASHNQLSNVFQLENAATPWFSETGFLDEETIFSMPSLLMDMAQGMLLSPPRMSPHNSPENSVGESLWNYF* |
ORF Type | complete |
Blastp | Ethylene-responsive transcription factor ERF026 from Arabidopsis with 53.63% of identity |
---|---|
Blastx | Ethylene-responsive transcription factor ERF026 from Arabidopsis with 55.62% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019432066.1) |
Pfam | AP2 domain (PF00847.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer