Protein coding transcript 129000

• Transcript: Ll_transcript_523174
• CDS coordinates: 1-318 (+)
• Peptide sequence: FHKMVLPQVLVSARQVPALLRRNFGICVPAAQKASDPIQQLFVDKIREYKSKSSGGKMVEATPEIQKELAAELERVQKTYGFAAGANVSDLPPMKFQDPDLRDAV*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_523174

• Blastp: ATP synthase-coupling factor 6, mitochondrial from Sophophora with 50.51% of identity
• Blastx: ATP synthase-coupling factor 6, mitochondrial from Sophophora with 50.51% of identity
• Eggnog: Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain(ENOG41122G1)
• Kegg: Link to kegg annotations (Dmel_CG4412)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459620.1)
• Pfam: Mitochondrial ATP synthase coupling factor 6 (PF05511.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;