Transcript | Ll_transcript_412658 |
---|---|
CDS coordinates | 1-369 (+) |
Peptide sequence | HCSAMTRLKKTLNTTLILKRNYATSFQWETALREKGSGKFETTRVIQLVYKNRLYWRHVAKMETDRERLLLCYQTNHQVVQGRFPVNRDLALELAALMAQIDFGEYHAEKGRGSGGVRDLQVL |
ORF Type | internal |
Blastp | Uncharacterized protein CG43867 from Sophophora with 74.16% of identity |
---|---|
Blastx | Uncharacterized protein CG43867 from Sophophora with 74.16% of identity |
Eggnog | Pleckstrin homology domain containing, family H (With MyTH4 domain) member(ENOG410XPCT) |
Kegg | Link to kegg annotations (Dmel_CG43867) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_020998735.1) |
Pfam | FERM central domain (PF00373.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer