Protein coding transcript 129070

• Transcript: Ll_transcript_412658
• CDS coordinates: 1-369 (+)
• Peptide sequence: HCSAMTRLKKTLNTTLILKRNYATSFQWETALREKGSGKFETTRVIQLVYKNRLYWRHVAKMETDRERLLLCYQTNHQVVQGRFPVNRDLALELAALMAQIDFGEYHAEKGRGSGGVRDLQVL
• ORF Type: internal

Annotations of Ll_transcript_412658

• Blastp: Uncharacterized protein CG43867 from Sophophora with 74.16% of identity
• Blastx: Uncharacterized protein CG43867 from Sophophora with 74.16% of identity
• Eggnog: Pleckstrin homology domain containing, family H (With MyTH4 domain) member(ENOG410XPCT)
• Kegg: Link to kegg annotations (Dmel_CG43867)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020998735.1)
• Pfam: FERM central domain (PF00373.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;