Transcript | Ll_transcript_511172 |
---|---|
CDS coordinates | 3-392 (+) |
Peptide sequence | REARVQMMQQQQQQQHVLENKAGKNQWVRVRQSGKSYKELSALHLCQEFQAHDGCIWTMEFSLDGRYLASAGEDKVIHVWEVQECEVMSLRPEEGNLTPIHPSLLACSDRNGHAEGPPLFSEKKKRSKFG |
ORF Type | internal |
Blastp | - |
---|---|
Blastx | Uncharacterized WD repeat-containing protein all2124 from Nostoc with 43.59% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019448589.1) |
Pfam | WD domain, G-beta repeat (PF00400.31) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer