Protein coding transcript 129157

• Transcript: Ll_transcript_427565
• CDS coordinates: 77-484 (+)
• Peptide sequence: MLLAFVYQLNQLPIFQLETLLSFWQHLMLLCLQKYDQQQSLWSSSCCFCFPQNVKLLAHSLGHCSHSTTAEQDSSMHSLVLKQCELAFDHFLGKCCVLSLSIVQLKFYHKCDLMIQSPDPSLNQVKSGNEIHREY*
• ORF Type: complete

Annotations of Ll_transcript_427565

• Blastp: U-box domain-containing protein 1 from Medicago with 80.82% of identity
• Blastx: U-box domain-containing protein 1 from Medicago with 82.5% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (MTR_5g083030)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461097.1)
• Pfam: U-box domain (PF04564.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;