Protein coding transcript 1292

• Transcript: Ll_transcript_358560
• CDS coordinates: 1535-1990 (+)
• Peptide sequence: MDFVRGIIEDDGKGFMGGSHYSRFHEEQDADFVHIKMQRNNTFVTVTDNKGNVKLSGSAGSLKEMKTGQKLSRYAAEATAEVVGRRSRGLGLKSVVMKVNGFTHFRRKRQAILSWREGFADSRGDRNPIVYIEDTTRKPHNGCRLPKKRRI*
• ORF Type: complete

Annotations of Ll_transcript_358560

• Blastp: Probable ribosomal protein S11, mitochondrial from Arabidopsis with 61.84% of identity
• Blastx: Probable ribosomal protein S11, mitochondrial from Arabidopsis with 56.4% of identity
• Eggnog: Located on the platform of the 30S subunit, it bridges several disparate RNA helices of the 16S rRNA. Forms part of the Shine-Dalgarno cleft in the 70S ribosome (By similarity)(COG0100)
• Kegg: Link to kegg annotations (AT1G31817)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449420.1)
• Pfam: Ribosomal protein S11 (PF00411.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;