Protein coding transcript 129307

• Transcript: Ll_transcript_427378
• CDS coordinates: 331-1155 (+)
• Peptide sequence: MKTIMAAKSPHDSSLSFSRRYLNFHWKKKGLGDEEEEEILNITSSTHFSEEDEKEEDNIHQLMVQMPKEVSVVPLEVKKKKHSSKSKFKSALHVFTKSHSLNSSNLRKRVMVGTLFGYRRGHVHFAFQENSKLGPTFLIQLATPTSVLVKEMASGLVRIALECEKKVGNNNKGVKLLEEPLWRTYCNGKKCGYANRHECGPEEWKVLKAVEPISMGAGVLPMSSVGNGVGSEGELMYMRAKYERVVGSKDSEAFYMVNPDGSGGPELSIYLLRV*
• ORF Type: complete

Annotations of Ll_transcript_427378

• Blastp: Protein MIZU-KUSSEI 1 from Arabidopsis with 55.56% of identity
• Blastx: Protein MIZU-KUSSEI 1 from Arabidopsis with 52.78% of identity
• Eggnog: DUF617 domain containing protein(ENOG4111IZ9)
• Kegg: Link to kegg annotations (AT2G41660)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459689.1)
• Pfam: Protein of unknown function, DUF617 (PF04759.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;