Protein coding transcript 129497

• Transcript: Ll_transcript_351463
• CDS coordinates: 3-329 (+)
• Peptide sequence: ATATNSGALTCYQQNQSSFPYPDTCCVCKINGCEGCNFFLQETERKKERKYRGVRQRPWGKWVAEIRDPRRAKRVWLGTFETAEKAAKAYDKAAIEFHGARAKTNFEFQ
• ORF Type: internal

Annotations of Ll_transcript_351463

• Blastp: Ethylene-responsive transcription factor ERF112 from Arabidopsis with 65.75% of identity
• Blastx: Ethylene-responsive transcription factor ERF109 from Arabidopsis with 47.58% of identity
• Eggnog: Transcription factor(ENOG410YY7D)
• Kegg: Link to kegg annotations (AT2G33710)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004509207.1)
• Pfam: AP2 domain (PF00847.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;