Protein coding transcript 1295

• Transcript: Ll_transcript_358545
• CDS coordinates: 3-596 (+)
• Peptide sequence: TRHTLFLLSCLYVVVLCFIIVSIEKTMVMMLSSSSTFSLLHPTPLLPFHNSLSFSSKNLTFSPFKPSSLTLSASSSDSPLLAQQQEQDQSLLNQSSSQQSQSPQKLGVVVKPNDKPRLVLKFIWMEKNIGIALDQMIPGHGTIPLSPYYFWPRKDAWEELRELLESKPWISQKQMIILLNQATDIINLWQQSGGNLV*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_358545

• Blastp: 30S ribosomal protein 3, chloroplastic from Spinacia with 63.4% of identity
• Blastx: 30S ribosomal protein 3, chloroplastic from Spinacia with 90% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456237.1)
• Pfam: Plastid and cyanobacterial ribosomal protein (PSRP-3 / Ycf65) (PF04839.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;