Protein coding transcript 129514

• Transcript: Ll_transcript_491437
• CDS coordinates: 1-636 (+)
• Peptide sequence: LAGALPSHARSTDDGLYRAIDTYLKAHPSVSKEERKGLCRLIDSRKLTPEASLHAAQNERFPVRVVIQVLLSEQTKQNRFQDWSGSLFSGTRTSPNNGGGFENAPTRCLSKREINAQQVEIRKLKEDMHRLQRQCNVMQVQMEKMVEKKKGSLFKWKKFVIPSAFSKGLGMVEKIDENDEGEVGFGRNTPMDLKTKLVKCRTPNKLRKSMS*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_491437

• Blastp: Root phototropism protein 3 from Arabidopsis with 45.57% of identity
• Blastx: Root phototropism protein 3 from Arabidopsis with 45.57% of identity
• Eggnog: cellular response to blue light(ENOG41110QX)
• Kegg: Link to kegg annotations (AT5G64330)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443023.1)
• Pfam: NPH3 family (PF03000.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;