| Transcript | Ll_transcript_307712 |
|---|---|
| CDS coordinates | 2-298 (+) |
| Peptide sequence | FFSLISVIANLSLLTLTATFGFRIYKTVMQAIQKTSDGHPFKEILEMDVALPAEKVRQTSDLAVTHINAAIIELRRLFLVEDLVDSVKFGVTLWLLTYL |
| ORF Type | internal |
| Blastp | Reticulon-4 from Mus with 54.08% of identity |
|---|---|
| Blastx | Reticulon-4 from Mus with 54.08% of identity |
| Eggnog | Reticulon(ENOG410XPKH) |
| Kegg | Link to kegg annotations (68585) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_017428307.1) |
| Pfam | Reticulon (PF02453.16) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer