Transcript | Ll_transcript_307712 |
---|---|
CDS coordinates | 2-298 (+) |
Peptide sequence | FFSLISVIANLSLLTLTATFGFRIYKTVMQAIQKTSDGHPFKEILEMDVALPAEKVRQTSDLAVTHINAAIIELRRLFLVEDLVDSVKFGVTLWLLTYL |
ORF Type | internal |
Blastp | Reticulon-4 from Mus with 54.08% of identity |
---|---|
Blastx | Reticulon-4 from Mus with 54.08% of identity |
Eggnog | Reticulon(ENOG410XPKH) |
Kegg | Link to kegg annotations (68585) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_017428307.1) |
Pfam | Reticulon (PF02453.16) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer