Protein coding transcript 129565

• Transcript: Ll_transcript_307737
• CDS coordinates: 3-503 (+)
• Peptide sequence: DITSRRKVPILVGGSNSLIHALLVERFNPELSVFDQFDELSPTIQNELTRLRYECCFLWVDVSFQVLSDYLLKRVDEMLDSGMVDELAEFFDPESDDLDYDSAHRSGMRKAIGVPEFDRYFKEYPPPFRKRGCCWVGEDRVRKGAYDFAVRAIKDNTCQLAKRQIEK
• ORF Type: internal

Annotations of Ll_transcript_307737

• Blastp: Adenylate isopentenyltransferase from Humulus with 59.2% of identity
• Blastx: Adenylate isopentenyltransferase from Humulus with 59.2% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AAS94327)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430145.1)
• Pfam: IPP transferase (PF01715.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;