Protein coding transcript 129566

• Transcript: Ll_transcript_307739
• CDS coordinates: 2-331 (+)
• Peptide sequence: DDMHDLFIVGRGRGMISQLTAGLTDWSECPELGAIGDLLASSDFASSASVLVVQQYIGAELDEGDGIVTPDYNAMQKHEDFISQISHHSATTPPPSERSTVFSVESFHR*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_307739

• Blastp: Cation/H(+) antiporter 15 from Arabidopsis with 78.46% of identity
• Blastx: Cation/H(+) antiporter 15 from Arabidopsis with 78.46% of identity
• Eggnog: Sodium hydrogen exchanger(COG0475)
• Kegg: Link to kegg annotations (AT2G13620)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462762.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;