Protein coding transcript 129571

• Transcript: Ll_transcript_339766
• CDS coordinates: 1-348 (+)
• Peptide sequence: QAYGLTEHSCITLTHAQKGLVSPQKNSVGFILPNLEVKFIDPDTGRSLPRNKPGELCVRSQCVMQGYYKQVGETAQTIDKNGWLHTGDIGFIDDEENVFIVDRIKELIKYKGFQVA
• ORF Type: internal

Annotations of Ll_transcript_339766

• Blastp: 4-coumarate--CoA ligase-like 9 from Oryza sativa with 75.63% of identity
• Blastx: 4-coumarate--CoA ligase-like 9 from Oryza sativa with 75.63% of identity
• Eggnog: Amp-dependent synthetase and ligase(COG0318)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447070.1)
• Pfam: AMP-binding enzyme (PF00501.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;