Protein coding transcript 129572

• Transcript: Ll_transcript_339736
• CDS coordinates: 2-394 (+)
• Peptide sequence: AATALFNLAIYNPNKVSIVNAGAITILVELLMDDKAGITDDSLAVLSLLLSYSQGLDEIKNSKSLVPLLIDLLRFGSVKGKENSITLLLGLCKEEGELVARHLLANPRSIPSLQGLAVDGSLRARRKADAL
• ORF Type: internal

Annotations of Ll_transcript_339736

• Blastp: U-box domain-containing protein 1 from Medicago with 87.79% of identity
• Blastx: U-box domain-containing protein 1 from Medicago with 87.79% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (MTR_5g083030)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461097.1)
• Pfam: Armadillo/beta-catenin-like repeat (PF00514.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;