Transcript | Ll_transcript_334413 |
---|---|
CDS coordinates | 32-304 (+) |
Peptide sequence | MRSHEMPKGYRRGPKTGKNPVHNVSEEVSFHWPWNDKVDWRTKGYVAHVKDQGTCGSCWAFAAIGAVEGQGFKKTGMLIPLSEQNLVDCTR |
ORF Type | 3prime_partial |
Blastp | - |
---|---|
Blastx | Cathepsin L from Sophophora with 49.53% of identity |
Eggnog | cathepsin(COG4870) |
Kegg | Link to kegg annotations (Dmel_CG6692) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_013457448.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer