| Transcript | Ll_transcript_340825 |
|---|---|
| CDS coordinates | 2-304 (+) |
| Peptide sequence | PIERMMVPHVLVNVGGNKQICEFCEYFLHYVQTELAAEKTVDKVKAVVEGACDRLPKTINTQCKDFVDAYGNAFIAILVQEVDPSVVCPKLGFCPSKDTSR |
| ORF Type | internal |
| Blastp | Saposin-C from Cavia with 34.21% of identity |
|---|---|
| Blastx | Saposin-C from Cavia with 34.21% of identity |
| Eggnog | surfactant protein B(ENOG410XSI5) |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_004486175.1) |
| Pfam | Saposin-like type B, region 1 (PF05184.14) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer