Protein coding transcript 12972

• Transcript: Ll_transcript_357904
• CDS coordinates: 1-522 (+)
• Peptide sequence: RRPNKTLQLILLPSSTSLQFISLTVTDSIQPQTLGTMEGELANIKKWNILYPVYINSKKTMAQGRRIGLTKACENPTCAEIGDCCTYLKIPFAIEIDKAYPRDFMQRGRVRVLLKKEDGSLFNPAIATRKQLLLRIAEMVPRHPGRTKKQETASSSSTAGPSAKSGKGGKKRR*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_357904

• Blastp: Signal recognition particle 19 kDa protein from Oryza sativa with 69.6% of identity
• Blastx: Signal recognition particle 19 kDa protein from Oryza sativa with 70.18% of identity
• Eggnog: Involved in targeting and insertion of nascent membrane proteins into the cytoplasmic membrane. Binds directly to 7S RNA and mediates binding of the 54 kDa subunit of the SRP (By similarity)(COG1400)
• Kegg: Link to kegg annotations (4340957)
• CantataDB: Link to cantataDB annotations (CNT0000044)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418120.1)
• Pfam: SRP19 protein (PF01922.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;