Protein coding transcript 129725

• Transcript: Ll_transcript_334391
• CDS coordinates: 210-1199 (+)
• Peptide sequence: MADSDEVAKSTENQQTEQVCSFFRKPVNKRNIRKRTVDNEDDDEDSRNESSLLHIQKKTLKPDNKLYFSSSTSKSSASAEQSEESEKPVFHFESAREIQVQHDNKATATLETETDFSRDARAIRERALKQAEESLKGKGTSSGGGDKLYKGLNSYKDYKAGFRREQTIASEKAGGSHGPLRASAHIRVSARFDYQPDICKDYKETGYCGYGDSCKFMHDRGDYKSGWQMEKEWEEAEKARKMRLAAGEDAEEEGASLSDEDDEDALPFACFICRNPFVDPVVTKCKHYFCEHCALKHHAKNKKCFVCNQPTLGIFNVAQEIRRKIAEGK*
• ORF Type: complete

Annotations of Ll_transcript_334391

• Blastp: Zinc finger CCCH domain-containing protein 1 from Arabidopsis with 69.18% of identity
• Blastx: Zinc finger CCCH domain-containing protein 1 from Arabidopsis with 66.17% of identity
• Eggnog: Ring finger protein(COG5152)
• Kegg: Link to kegg annotations (AT1G01350)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424045.1)
• Pfam: Zinc finger C-x8-C-x5-C-x3-H type (and similar) (PF00642.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;