Protein coding transcript 129726

• Transcript: Ll_transcript_334392
• CDS coordinates: 1007-1348 (+)
• Peptide sequence: MHDRGDYKSGWQMEKEWEEAEKARKMRLAAGEDAEEEGASLSDEDDEDALPFACFICRNPFVDPVVTKCKHYFCEHCALKHHAKNKKCFVCNQPTLGIFNVAQEIRRKIAEGK*
• ORF Type: complete

Annotations of Ll_transcript_334392

• Blastp: Zinc finger CCCH domain-containing protein 1 from Arabidopsis with 72.97% of identity
• Blastx: Zinc finger CCCH domain-containing protein 1 from Arabidopsis with 69.9% of identity
• Eggnog: Ring finger protein(COG5152)
• Kegg: Link to kegg annotations (AT1G01350)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424045.1)
• Pfam: Zinc finger, C3HC4 type (RING finger) (PF13920.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;