Transcript | Ll_transcript_357905 |
---|---|
CDS coordinates | 227-637 (+) |
Peptide sequence | MEGELANIKKWNILYPVYINSKKTMAQGRRIGLTKACENPTCAEIGDCCTYFKLPFAIEIDKAYPRDFMQRGRVRVLLKKEDGTLFNPAIASRKQLMLRIAEMVPRHPGRTKKPEAASTSIGGPSTKSGKGGKKRR* |
ORF Type | complete |
Blastp | Signal recognition particle 19 kDa protein from Oryza sativa with 64.52% of identity |
---|---|
Blastx | Signal recognition particle 19 kDa protein from Arabidopsis with 70.27% of identity |
Eggnog | Involved in targeting and insertion of nascent membrane proteins into the cytoplasmic membrane. Binds directly to 7S RNA and mediates binding of the 54 kDa subunit of the SRP (By similarity)(COG1400) |
Kegg | Link to kegg annotations (4340957) |
CantataDB | Link to cantataDB annotations (CNT0000044) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019463344.1) |
Pfam | SRP19 protein (PF01922.16) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer