Transcript | Ll_transcript_520107 |
---|---|
CDS coordinates | 2-394 (+) |
Peptide sequence | SAIIAADSYSRNFEKARNPEYQFQDESESLSQTLASQKTSGQRAMKWASDNRYSIVFASWVASMGGALAIVGRSPHLTGQQKLVQARVYAQGLTMAVVIASLALEGADMKAARGDGKVTGAIKQKRLSDKD |
ORF Type | internal |
Blastp | - |
---|---|
Blastx | Respiratory supercomplex factor 2, mitochondrial from Saccharomyces with 40% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (YNR018W) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_020234002.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer