Transcript | Ll_transcript_520094 |
---|---|
CDS coordinates | 43-420 (+) |
Peptide sequence | MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQQQRLKIMEYFEKKEKQVELQKKIQSSNMLNQARLKALKVREDHIRTVLDEARRRLGEVTRNQQKYGNVLQQLIIQGLYQ |
ORF Type | 3prime_partial |
Blastp | V-type proton ATPase subunit E from Sophophora with 87.3% of identity |
---|---|
Blastx | V-type proton ATPase subunit E from Sophophora with 87.3% of identity |
Eggnog | Produces ATP from ADP in the presence of a proton gradient across the membrane (By similarity)(COG1390) |
Kegg | Link to kegg annotations (Dmel_CG1088) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_016189435.1) |
Pfam | ATP synthase (E/31 kDa) subunit (PF01991.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer