Protein coding transcript 129778

• Transcript: Ll_transcript_520094
• CDS coordinates: 43-420 (+)
• Peptide sequence: MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQQQRLKIMEYFEKKEKQVELQKKIQSSNMLNQARLKALKVREDHIRTVLDEARRRLGEVTRNQQKYGNVLQQLIIQGLYQ
• ORF Type: 3prime_partial

Annotations of Ll_transcript_520094

• Blastp: V-type proton ATPase subunit E from Sophophora with 87.3% of identity
• Blastx: V-type proton ATPase subunit E from Sophophora with 87.3% of identity
• Eggnog: Produces ATP from ADP in the presence of a proton gradient across the membrane (By similarity)(COG1390)
• Kegg: Link to kegg annotations (Dmel_CG1088)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_016189435.1)
• Pfam: ATP synthase (E/31 kDa) subunit (PF01991.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;