Transcript | Ll_transcript_520110 |
---|---|
CDS coordinates | 2-403 (+) |
Peptide sequence | RSSSLKVVQHMTTYWSILEKVPGSKLRLTKIDDEIHEHFLKEFPDYDLKARINEDEMKSKAGKERWRSFINTYENKIDDYNFGTMLRSSPAEEYSQEETIFAVRMQFYAIEIARNRAGLNDWIYEKAQKEGSA* |
ORF Type | 5prime_partial |
Blastp | - |
---|---|
Blastx | Protein PBDC1 homolog from Saccharomyces with 55.28% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (YPL225W) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (NP_001240158.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer