Transcript | Ll_transcript_401547 |
---|---|
CDS coordinates | 2-304 (+) |
Peptide sequence | SKKIKTGWFSKMFIIVITLIGSIIYHGHALSISLNDVECVSEYIANEGDIISGNFIVMDHDIFWGSDHPGIDFSVTAPDGTMAYSLKGISGEKFEFKALHH |
ORF Type | internal |
Blastp | Transmembrane emp24 domain-containing protein p24beta3 from Arabidopsis with 58.62% of identity |
---|---|
Blastx | Transmembrane emp24 domain-containing protein p24beta3 from Arabidopsis with 58.62% of identity |
Eggnog | transmembrane emp24 domain trafficking protein 2(ENOG410XQCK) |
Kegg | Link to kegg annotations (AT3G22845) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019456551.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer