Protein coding transcript 129784

• Transcript: Ll_transcript_401547
• CDS coordinates: 2-304 (+)
• Peptide sequence: SKKIKTGWFSKMFIIVITLIGSIIYHGHALSISLNDVECVSEYIANEGDIISGNFIVMDHDIFWGSDHPGIDFSVTAPDGTMAYSLKGISGEKFEFKALHH
• ORF Type: internal

Annotations of Ll_transcript_401547

• Blastp: Transmembrane emp24 domain-containing protein p24beta3 from Arabidopsis with 58.62% of identity
• Blastx: Transmembrane emp24 domain-containing protein p24beta3 from Arabidopsis with 58.62% of identity
• Eggnog: transmembrane emp24 domain trafficking protein 2(ENOG410XQCK)
• Kegg: Link to kegg annotations (AT3G22845)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456551.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;