Transcript | Ll_transcript_444233 |
---|---|
CDS coordinates | 108-863 (+) |
Peptide sequence | MEHLHAKGIIHRDLKPSNLILTKDKKHVKLADFGIAREEIGDGMTSEAGTYRYMAPELFSKSPLPKGAKKCYDRKADVYSFAMVLWSLVKNETPFKDRKDLMAAYAAANNMRPSLDEFPPCLVPLVKSCWEEDPKLRPEFQEITTILTTLLRICRSTGITPLTSIAESDEELESNTNGQSSKAKGPKSLQSVENISKRRTIKSNGLIDVKGESLSQRKAKTPKADFSRTSKSKWNNIKLKCLSFFKHCFSI* |
ORF Type | complete |
Blastp | Serine/threonine-protein kinase STY17 from Arabidopsis with 43.87% of identity |
---|---|
Blastx | Serine/threonine-protein kinase HT1 from Arabidopsis with 42.62% of identity |
Eggnog | Serine Threonine protein kinase(COG0515) |
Kegg | Link to kegg annotations (AT4G35780) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019420845.1) |
Pfam | Protein kinase domain (PF00069.24) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer