Transcript | Ll_transcript_481968 |
---|---|
CDS coordinates | 3-299 (+) |
Peptide sequence | RGVAPKSQKGNKIVKKATVQKALKVKQKVIKGSHGTRTRKIRTSVHFRRPKTFEPPRKPKYPRKSVPTRNRMDAYNIIKSPLTTEAAMKKIEDNNTLVF |
ORF Type | internal |
Blastp | - |
---|---|
Blastx | 60S ribosomal protein L23a 2 from Caenorhabditis with 55.56% of identity |
Eggnog | One of the early assembly proteins it binds 23S rRNA. One of the proteins that surrounds the polypeptide exit tunnel on the outside of the ribosome. Forms the main docking site for trigger factor binding to the ribosome (By similarity)(COG0089) |
Kegg | Link to kegg annotations (CELE_F52B5.6) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (NP_001242083.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer