Protein coding transcript 129792

• Transcript: Ll_transcript_481975
• CDS coordinates: 419-853 (+)
• Peptide sequence: MVTLSGAHTIGRSHCSAFSNRLYNFSATSRQDPSLDPSYASFLKRQCPQGNTNQNLVVPMDPSSPGTIDAGYYNDILANRALFTSDQTLLTNTETASLVNENARDPYQWASKLADAMVKMGQIGALTGNAGEVRTNCRVVNSYQ*
• ORF Type: complete

Annotations of Ll_transcript_481975

• Blastp: Peroxidase 5 from Vitis with 70.42% of identity
• Blastx: Peroxidase 5 from Vitis with 73.33% of identity
• Eggnog: peroxidase(ENOG410YDTD)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416211.1)
• Pfam: Peroxidase (PF00141.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;