Transcript | Ll_transcript_481975 |
---|---|
CDS coordinates | 419-853 (+) |
Peptide sequence | MVTLSGAHTIGRSHCSAFSNRLYNFSATSRQDPSLDPSYASFLKRQCPQGNTNQNLVVPMDPSSPGTIDAGYYNDILANRALFTSDQTLLTNTETASLVNENARDPYQWASKLADAMVKMGQIGALTGNAGEVRTNCRVVNSYQ* |
ORF Type | complete |
Blastp | Peroxidase 5 from Vitis with 70.42% of identity |
---|---|
Blastx | Peroxidase 5 from Vitis with 73.33% of identity |
Eggnog | peroxidase(ENOG410YDTD) |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019416211.1) |
Pfam | Peroxidase (PF00141.22) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer