Protein coding transcript 129813

• Transcript: Ll_transcript_239386
• CDS coordinates: 3-545 (+)
• Peptide sequence: KIYGIADTGSDLIWTQCVPCEGCYKQLNPLFDPTKSSTYSNISCQTDQCRRWLDTGVCSPQNQCNYTYAYASASVTRGVLAQDTVTFTSPTGNPISLPAIAFGCGHNDTGTFNDHEMGIIGLGGGSASLISQIGPSIGGRKFSQCLVPFHTDVSITSKISFGDGSEVSGDGVVSTPMVAKE
• ORF Type: internal

Annotations of Ll_transcript_239386

• Blastp: Aspartic proteinase CDR1 from Arabidopsis with 53.33% of identity
• Blastx: Aspartic proteinase CDR1 from Arabidopsis with 53.33% of identity
• Eggnog: aspartic(ENOG410XNV7)
• Kegg: Link to kegg annotations (AT5G33340)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423110.1)
• Pfam: Xylanase inhibitor N-terminal (PF14543.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;