| Transcript | Ll_transcript_239396 |
|---|---|
| CDS coordinates | 2-337 (+) |
| Peptide sequence | ALLLLDSPIQEAEHIGLVCLPQQNQIIDSTNCFATGWGKDNFGKDGRYSSILKKIELPIVQRQRCQELLRTTRLGIHFNLDKSFTCAGGIAGRDTCTGDGGSPLVCPDPQNP |
| ORF Type | internal |
| Blastp | Serine protease 44 from Homo with 38.32% of identity |
|---|---|
| Blastx | Serine protease 44 from Homo with 38.32% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_017434537.1) |
| Pfam | Trypsin (PF00089.25) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer