Protein coding transcript 129819

• Transcript: Ll_transcript_239406
• CDS coordinates: 80-481 (+)
• Peptide sequence: MPQYKLHYFNLTALGEPIRFLLAYGKADWEDIRYEPAEWEKVKSSMPFGQMPVLEIDGKQYAQSIALSRYVAKQVGLYGKDDLESLQIDQAADLSTDFRTKIGGWFYDAIPESKASKEAPLFNEQIPYYLKKFE
• ORF Type: 3prime_partial

Annotations of Ll_transcript_239406

• Blastp: Glutathione S-transferase from Blattella with 57.14% of identity
• Blastx: Glutathione S-transferase from Blattella with 57.14% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_013458730.1)
• Pfam: Glutathione S-transferase, N-terminal domain (PF02798.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;