| Transcript | Ll_transcript_46208 |
|---|---|
| CDS coordinates | 2-334 (+) |
| Peptide sequence | DPDVCKWNHVQCDKGKRVTSIQIGNQNLQGSLPKELEKLSELENFECQGNNLTGSFPYLTKSLQNLIIQDNMFSSFPNDFFTDMSNLEAVSLDDNPFPQWQVPGSLKDCVA |
| ORF Type | internal |
| Blastp | Receptor protein kinase TMK1 from Arabidopsis with 47.79% of identity |
|---|---|
| Blastx | Receptor protein kinase TMK1 from Arabidopsis with 47.79% of identity |
| Eggnog | receptor protein kinase(ENOG41102Z7) |
| Kegg | Link to kegg annotations (AT1G66150) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019437448.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer