Protein coding transcript 129831

• Transcript: Ll_transcript_151149
• CDS coordinates: 1-375 (-)
• Peptide sequence: MRIFVCDLMSAGYNVPGDEEHGFKYFFRMSKTTFEYICSLVREDLISRPPSGLINIEGRLLSVEKQVAIALRRLASGESQVSVGASFGVGQSTVSQVTWRFIEALEERARHHLNWPDFDRIQQIK
• ORF Type: 3prime_partial

Annotations of Ll_transcript_151149

• Blastp: Protein ANTAGONIST OF LIKE HETEROCHROMATIN PROTEIN 1 from Arabidopsis with 83.05% of identity
• Blastx: Protein ANTAGONIST OF LIKE HETEROCHROMATIN PROTEIN 1 from Arabidopsis with 83.05% of identity
• Eggnog: transposon protein(ENOG411206Y)
• Kegg: Link to kegg annotations (AT3G63270)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019457076.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;