Protein coding transcript 129833

• Transcript: Ll_transcript_151150
• CDS coordinates: 131-463 (-)
• Peptide sequence: EIEQCKGSGIVLSFGEVEVFVGDCVKNVDNVKFVVSGLTRLLEMHHGKIWLVGVAQTSDAYSKFMGLFPNVEKDWDLHLLTITYPTPSMEGLYPKSRWVFNFLFHFHFLQ*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_151150

• Blastp: Protein SMAX1-LIKE 7 from Arabidopsis with 41.67% of identity
• Blastx: Protein SMAX1-LIKE 8 from Arabidopsis with 41.38% of identity
• Eggnog: ATP-dependent CLP protease ATP-binding subunit(COG0542)
• Kegg: Link to kegg annotations (AT2G29970)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019455714.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;