Protein coding transcript 129834

• Transcript: Ll_transcript_151155
• CDS coordinates: 1-318 (-)
• Peptide sequence: ENSAMKAVEFDGVEFHGRVLTVKLDDGKRLRDKELERERWVKGNGDKGEYRSKWHEERDGSRKEFQKVLETEPENWQAVVSAFERIKKPARKEYGLMVKYYARRGD
• ORF Type: internal

Annotations of Ll_transcript_151155

• Blastp: Pentatricopeptide repeat-containing protein At5g04810, chloroplastic from Arabidopsis with 66.67% of identity
• Blastx: Pentatricopeptide repeat-containing protein At5g04810, chloroplastic from Arabidopsis with 66.67% of identity
• Eggnog: Pentatricopeptide repeat-containing protein(ENOG410Z7Z7)
• Kegg: Link to kegg annotations (AT5G04810)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461472.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;