Transcript | Ll_transcript_170354 |
---|---|
CDS coordinates | 2-349 (-) |
Peptide sequence | KDIQASFDKGIKIDPQLYASLLETCYNMQAIDCGIRLHRLIPPTLLHRNIGISSKLVRLYASYGYMDEAHQVFDQMSNRGHSAFPWNSLISGYAQMGLYHDAIALYFQMVEEDVEP |
ORF Type | internal |
Blastp | Pentatricopeptide repeat-containing protein At4g25270, chloroplastic from Arabidopsis with 62.93% of identity |
---|---|
Blastx | Pentatricopeptide repeat-containing protein At4g25270, chloroplastic from Arabidopsis with 62.93% of identity |
Eggnog | Pentatricopeptide repeat-containing protein(ENOG410Z7Z7) |
Kegg | Link to kegg annotations (AT4G25270) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019465018.1) |
Pfam | PPR repeat (PF01535.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer