Protein coding transcript 129839

• Transcript: Ll_transcript_210136
• CDS coordinates: 3-356 (+)
• Peptide sequence: VMKLLEVVRTPETSDETYEKLMAWAKAIGKTAITCKDTPGFVVNRLLVPLMAEAIRMLERGDASPRDIDIAMKLGAGHPMGPIELADYVGHDTTNSIINGWHEKFPENPLFNPLPSLQ
• ORF Type: internal

Annotations of Ll_transcript_210136

• Blastp: Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial from Homo with 65.25% of identity
• Blastx: Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial from Homo with 65.25% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (3033)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004510030.1)
• Pfam: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain (PF02737.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;