Protein coding transcript 129840

• Transcript: Ll_transcript_210139
• CDS coordinates: 130-636 (+)
• Peptide sequence: MVPIEAWSGRKPSVGHLRVFGSLAFRHVPDQKRTKLQDKSEAMVLVGYHPTGAYRLYDPIKDKITISRDVLILEQEQWDWNQMKSGLGRILHNPIDESKSSSEVQPELNSEVVEVSEPDLNITKRSQRQRTKPTRFSDYEVHTDDQITEEGELIHLALMAESVPMNDLD
• ORF Type: 3prime_partial

Annotations of Ll_transcript_210139

• Blastp: Retrovirus-related Pol polyprotein from transposon TNT 1-94 from Nicotiana with 46.05% of identity
• Blastx: Retrovirus-related Pol polyprotein from transposon TNT 1-94 from Nicotiana with 41.67% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019465092.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;