Transcript | Ll_transcript_69783 |
---|---|
CDS coordinates | 2-397 (+) |
Peptide sequence | FVFLLISLILIAIDKGTEDTTNGPLEAKFNDFHAYRYMLSTIVIGFAYNLVQMAFSIFTVVSGKRVISGDGGYFFDFFGDKIISYLILSGSAAGFGVSDDLHSFFNAQELPFNSFFAKANASATLLLFAFLF |
ORF Type | internal |
Blastp | CASP-like protein 4D1 from Soja with 71.21% of identity |
---|---|
Blastx | CASP-like protein 4D1 from Soja with 76.24% of identity |
Eggnog | CASP-like protein(ENOG410ZDYN) |
Kegg | Link to kegg annotations (100500517) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019454443.1) |
Pfam | Domain of unknown function (DUF588) (PF04535.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer