Protein coding transcript 129848

• Transcript: Ll_transcript_198617
• CDS coordinates: 56-370 (+)
• Peptide sequence: MESNKKYHVIAKLGEKTSTSDSDGIIIKKRPILINSFKIKSALKELTGLIEQIPPMYSAIKHNGVPLYKYARQGLNIKRSIRKVLIHDISSIHQEKNLIEFKIFC
• ORF Type: 3prime_partial

Annotations of Ll_transcript_198617

• Blastp: tRNA pseudouridine synthase B from Buchnera with 100% of identity
• Blastx: tRNA pseudouridine synthase B from Buchnera with 100% of identity
• Eggnog: Responsible for synthesis of pseudouridine from uracil- 55 in the psi GC loop of transfer RNAs (By similarity)(COG0130)
• Kegg: Link to kegg annotations (BU375)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004489195.1)
• Pfam: TruB family pseudouridylate synthase (N terminal domain) (PF01509.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;